PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0007s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB_related
Protein Properties Length: 177aa    MW: 20107.4 Da    PI: 10.3503
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0007s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.11.1e-1493137347
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  SapurV1A.0007s0060.1.p  93 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 137
                             8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.83686142IPR017930Myb domain
SuperFamilySSF466891.79E-1788142IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-1789140IPR006447Myb domain, plants
SMARTSM007171.8E-1090140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-1192137IPR009057Homeodomain-like
CDDcd001679.31E-1093138No hitNo description
PfamPF002497.1E-1293137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MESRLFSQCG NSSRTCEKSP SYGDQNVTPT GIMLFGVRVT EGAASFRKSV SMINLSQYEQ  60
PHEEPSADVA AGYESDDVVH ASGRSRERKR GVPWTEEEHK LFLLGLQKVG KGDWRGISRN  120
FVKTRTPTQV ASHAQKYFLR RNNQNRRRRR SSLFDITTDT VNLQNWWSAH ETKITL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473911e-141EF147391.1 Populus trichocarpa clone WS01230_F05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315700.28e-96DNA-binding family protein
SwissprotQ2V9B04e-48MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLB9HU858e-96B9HU85_POPTR; DNA-binding family protein
STRINGPOPTR_0010s04860.12e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.28e-67MYB_related family protein